PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593301.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 259aa    MW: 29512.8 Da    PI: 5.4748
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593301.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601261.8e-39361351100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l++ ++++am +++++++ara+dP++G++++i+klq q+e +k+el+
  XP_013593301.1  36 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKDLSPPDKDAAMYTIMFQSDARANDPIEGCYSIIRKLQYQIEYSKNELD 130
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++ ++
  XP_013593301.1 131 MVIQQ 135
                     88776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.85935136IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-3636132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MPSGKPSSSV FSLHPKPTPL KPSSSTTSNN NTTNQACAAC KYQRRKCAPD CLLAPYFPHD  60
RHRQFLNAHK LFGVSNITKI IKDLSPPDKD AAMYTIMFQS DARANDPIEG CYSIIRKLQY  120
QIEYSKNELD MVIQQLAVFR NHHQEPHIQI QEPEDLSSFS SSCDLNNNNS ITYNYPLHHV  180
QEPVQQQQEQ QYCASGNFNG LQEDMWCLQL QDSSTTVNMK GGFIDECEDV KPVEEVSSET  240
HEFEHHHDGF VEEPYIISS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593301.10.0PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW11e-147LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A0D3ADU40.0A0A0D3ADU4_BRAOL; Uncharacterized protein
STRINGBra021513.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-140LOB domain-containing protein 22